Sermorelin Nasal Spray
Sermorelin is supplied by Direct SARMs Netherlands as a pre-mixed liquid nasal spray in 15ml and 30ml formats containing a synthetic peptide prepared exclusively for laboratory research and analytical documentation, and is available from Direct SARMs in 15 ml and 30 ml sizes.
99.3% purityBatch COA includedStore 2–8°C
Price range: $31.50 through $56.75
Buy more, save more
7.5% offspend $250.00
12.5% offspend $400.00
Spend $250.00 for 7.5% off on qualifying items · Applied automatically at checkout
Researchers who bought Sermorelin Nasal Spray also bought
Sermorelin Nasal Spray
Sermorelin is a synthetic analogue of GHRH, or growth hormone-releasing hormone, identified by the sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL. Experimental publications describe the peptide during investigations involving GHRH signalling, endocrine regulation, and growth hormone physiology. Direct SARMs Netherlands supplies Sermorelin as a pre-mixed liquid nasal spray containing 2mg in the 15ml format and 4mg in the 30ml format. HPLC and Certificate of Analysis documentation accompany the research material for laboratory identification and recordkeeping.
Benefits of the nasal spray format
1
The dispensing is pre-measured. Each time the spray mechanism is actuated, it releases a constant volume, which allows for repeatable dispensing when carrying out research procedures.
2
Convenient format. Compact spray bottles are straightforward to store, handle, and transport within an appropriate research environment.
3
Ready to use. Unlike lyophilized peptides, which are provided in vials, nasal spray formulations are in liquid form and do not need to be reconstituted before being handled in the laboratory.
4
Protected storage. The bottle protects the formulation by preventing unnecessary handling and exposure to the environment between research procedures.
5
Simple dispensing. The product can be dispensed easily. With an integrated spraying mechanism, it is not necessary to draw the liquid from a vial, offering a simple way to dispense the formulation during research.
Visit the Sermorelin Research Hub ▸
Sermorelin is supplied exclusively for laboratory research use. The information on this page is provided for scientific and educational reference and is based on available published research. This product is not intended for human or veterinary use, diagnosis, treatment, or prevention of any disease or medical condition. It is intended solely for qualified laboratory research and must be handled in accordance with applicable laboratory safety requirements.
Buy Sermorelin Nasal Spray Netherlands from Direct SARMS.
Additional information
| 15ml Size | Contains 2 mg Sermorelin peptide. |
| 30ml Size | Contains 4 mg Sermorelin peptide. |
| Purity | 99.3% |
| Molecular Weight | 3357.88 g/mol |
| Molecular Formula | C149H246N44O42S |
| Sequence(IUPAC) | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL. |
| Physical Features | Pre-mixed nasal spray liquid. |
General information
Applies to all Direct Sarms research compounds unless noted otherwise on the product.
Storage & handling
Store the nasal spray according to the instructions provided on the product label. Keep the bottle securely closed when not in use and protect it from excessive heat and direct light. Follow any product-specific refrigeration requirements stated on the label.
Shipping & discretion
Fully tracked dispatch with worldwide shipping available. Sent in plain, discreet outer packaging with no product description on the label.
FDA disclosure & intended use
These statements have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure or prevent any disease. Research use only — not for human or animal consumption. You must be 18+ and a qualified researcher.
Got a question about this Sermorelin compound?
Sermorelin Nasal Spray is designed for use in research and is available as a nasal spray containing sermorelin; it is provided exclusively for use in laboratory and analytical research and must not be used as food or for human consumption.
The term "nasal spray" refers only to the form in which the product is available and to the method of administration; it gives no instructions or recommendations as to how people should use the product.
Sermorelin is a synthetic peptide identical to growth hormone-releasing hormone (GHRH) and has always been the focus of scientific research into peptide signaling, receptor interactions, and endocrine pathways.
This product is meant for use in laboratory research only and must not be eaten by humans or be used for any clinical, medical, or therapeutic purpose; moreover, there is no information given regarding dosing or administration.
Certificate of Analysis
| Identity | Sermorelin | CONFORMS |
| Purity (HPLC) | 99.3% | CONFORMS |
| Mass (LC-MS) | 3357.88 g/mol | CONFORMS |
